DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and E02C12.9

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:205 Identity:49/205 - (23%)
Similarity:86/205 - (41%) Gaps:60/205 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYG 273
            ||.::.:::||          ...::.|||              |..:.|.|||||.:||:  :.
 Worm   181 ETFVVYQKLLK----------KYTKISELL--------------GFKSVLNHGDLWQSNMI--HS 219

  Fly   274 MRGEEGTPLKVK-IVDFQ---IAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLR 334
            |  |....||:: |:|:|   |...|....::|....|:.|   ..:..::.|.:|:..||....
 Worm   220 M--ENNGKLKLEAIIDWQSTVILPPGLDTAELIVGCLSAED---RREKGHDLLLLYHKTFINVFG 279

  Fly   335 SVNVDTSNYTYELF-LEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFSVLTKNTGAKTI 398
            |          |:| .||:|.:.::..|.|..::         :|   ..:.|...|:.|.|:.|
 Worm   280 S----------EVFSFEELQDSYNLYFPMAAILI---------VP---GMISFMTNTQITEAERI 322

  Fly   399 --VTKFEAIL 406
              ::|..||:
 Worm   323 HSMSKITAIV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 33/131 (25%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 49/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.