DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and T16G1.7

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_506233.1 Gene:T16G1.7 / 179774 WormBaseID:WBGene00011801 Length:436 Species:Caenorhabditis elegans


Alignment Length:416 Identity:88/416 - (21%)
Similarity:157/416 - (37%) Gaps:118/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VIEP-------HLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLT 70
            ::||       ||||...|...|..::      :|.:     .|::....|        ..|...
 Worm    62 LVEPEWTVPDEHLPEKFILKITSCLHV------HGLV-----EKMKGKSPG--------AFPAEQ 107

  Fly    71 NDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDR 135
            ....|.||:.|...:....|..|...|  |......:|..:|      |:..:...:|: ||   
 Worm   108 EAALWAIFENEAQQLHNREVNLYKITE--KWNKNETMLSPKI------YFYKKFDAENK-TK--- 160

  Fly   136 DAVLVQE---NVTTRGYRPGNRH-----RPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYV 192
             .:|..|   :||.       ||     :||.|..   :|..||...|  .:|.|.:.::..   
 Worm   161 -GILGMEFVSDVTI-------RHLYCNAKPYELHP---VLRSLATLQA--GSLHLTEDEINS--- 209

  Fly   193 RPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVN--RVKELLDIFQAF----------- 244
               ...||..    |....:||:|.:|:|...|   |::|  |:.|..:..:||           
 Worm   210 ---ISGFDFK----QMMGAMMNEEGMKNIYEQT---REINPERLTEKTNTVEAFGLEVVNFELSC 264

  Fly   245 ------QASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIF 303
                  ....||       |||||||..|::.|   ...:|.....|::|:|:...|:...|::.
 Worm   265 NLNKYVGIERDV-------LVHGDLWAANILWK---EENDGKFSVSKVIDYQLIHMGNPAEDLVR 319

  Fly   304 VLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAH--------VQL 360
            |..|::.....:.::...|..:|..|::.|..   |...|:    ||:::::..        |.:
 Worm   320 VFLSTLSGADRQAHWERLLEQFYEYFLEALGD---DKPPYS----LEQLKESYRCYFVSGGLVMM 377

  Fly   361 P--HAIFMMKVILADNSTIPKDYKDV 384
            |  ..|..:|:..::::...::|:::
 Worm   378 PMYGPIAQVKLSYSNDTESVEEYREI 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 71/328 (22%)
T16G1.7NP_506233.1 DUF1679 10..423 CDD:369592 88/416 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.