DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and F58B4.5

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:324 Identity:75/324 - (23%)
Similarity:129/324 - (39%) Gaps:65/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPG----NRHRPYNLAETVLILHYLAQYHAL 176
            |.:.|.|:...|....|    |.|:.|      |.|.    ..|......:.:.::|.:|.:.| 
 Worm   135 FTKVYASKPFDDENKLK----AYLISE------YYPNIHHIGMHESIPAEDLIPVIHAIAAFSA- 188

  Fly   177 PIALRLKKPQVYEEYVRP------YFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVK 235
             |.::|.:.:.  :|.|.      .|.:|     :|:...|.|| .:||    .:..|..:.:|:
 Worm   189 -IGMKLSEEET--KYARGADFLDIVFGQF-----MDEKSIERMN-VLLK----ASFPEEYLEKVE 240

  Fly   236 ELLDI-----FQAFQASNDVDDGPF----TTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQI 291
            |:|.|     ||.....|..:...|    ..|.|.|||.:|.:.   .|..|...||. |:|||.
 Worm   241 EMLKIYKDYYFQPQMIKNFKNTCQFFGYKPVLTHSDLWSSNFLC---TRDGEKVTLKA-IIDFQT 301

  Fly   292 AQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTA 356
            ....:...|:..:..|.:......:.....|..|||.|:..|..::|.   ||:    ::::.:.
 Worm   302 VSITTPAQDVGRLFASCLSTKDRREKADFLLEEYYNTFVNELDGMDVP---YTF----QQLKDSY 359

  Fly   357 HVQLPHAIFMMKVIL------ADNSTIPKDYKDVDFSV-LTKNTG-AKTIVTKFEAILRLGKKF 412
            .|..|   .|..::|      ..:|.:.::|||....| |.|..| .:.::|..|:.::...|:
 Worm   360 QVYFP---LMTTMVLPGIAPMLQHSNVTEEYKDSMKQVALDKMIGLLEDVITTHESNIKNFPKY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 57/239 (24%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 74/316 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.