DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1 and LGSN

DIOPT Version :9

Sequence 1:NP_001162839.1 Gene:Gs1 / 33172 FlyBaseID:FBgn0001142 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_011534191.1 Gene:LGSN / 51557 HGNCID:21016 Length:590 Species:Homo sapiens


Alignment Length:197 Identity:45/197 - (22%)
Similarity:77/197 - (39%) Gaps:30/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VEDLPDWQYDGSSTYQAHGENSDTTLKPRAIYRDPFKPGKNDVIVLCDTYSADGKPTASNKRAAF 154
            :|.:|:.:.:..:..:|...|||..|.|................|:|||::..|:|..::.|  :
Human   205 LEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPR--Y 267

  Fly   155 QAAIDLISDQEPWFGIEQEYTLLDVDGRPFGWPE------NGFPAPQGPYYCGVGADRVYARDLV 213
            .|...|...|...|.:...:.   .|...||.||      ..|||..   :.. ..|:.:.::||
Human   268 IAKRQLSHLQASGFSLLSAFI---YDFCIFGVPEILNSKIISFPALT---FLN-NHDQPFMQELV 325

  Fly   214 EAHVVACLYAGIDFAGTNAE-----VMPAQWEFQIGPA-GIKACDDLWVSRYILQRIAEEYGVVV 272
            :         |:...|.|.|     ..|.|.|....|. ||.:.|:.:..|..::.:|.:|..:.
Human   326 D---------GLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIA 381

  Fly   273 TF 274
            :|
Human   382 SF 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1NP_001162839.1 PLN02284 54..398 CDD:177922 45/197 (23%)
Gln-synt_C 151..>385 CDD:278546 31/136 (23%)
LGSNXP_011534191.1 GlnA 162..574 CDD:223252 45/197 (23%)
Gln-synt_N 167..252 CDD:281884 9/46 (20%)
Gln-synt_C 264..588 CDD:278546 31/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0174
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.