Sequence 1: | NP_001162839.1 | Gene: | Gs1 / 33172 | FlyBaseID: | FBgn0001142 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011534191.1 | Gene: | LGSN / 51557 | HGNCID: | 21016 | Length: | 590 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 77/197 - (39%) | Gaps: | 30/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 VEDLPDWQYDGSSTYQAHGENSDTTLKPRAIYRDPFKPGKNDVIVLCDTYSADGKPTASNKRAAF 154
Fly 155 QAAIDLISDQEPWFGIEQEYTLLDVDGRPFGWPE------NGFPAPQGPYYCGVGADRVYARDLV 213
Fly 214 EAHVVACLYAGIDFAGTNAE-----VMPAQWEFQIGPA-GIKACDDLWVSRYILQRIAEEYGVVV 272
Fly 273 TF 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gs1 | NP_001162839.1 | PLN02284 | 54..398 | CDD:177922 | 45/197 (23%) |
Gln-synt_C | 151..>385 | CDD:278546 | 31/136 (23%) | ||
LGSN | XP_011534191.1 | GlnA | 162..574 | CDD:223252 | 45/197 (23%) |
Gln-synt_N | 167..252 | CDD:281884 | 9/46 (20%) | ||
Gln-synt_C | 264..588 | CDD:278546 | 31/138 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0174 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |