DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1 and Lgsn

DIOPT Version :9

Sequence 1:NP_001162839.1 Gene:Gs1 / 33172 FlyBaseID:FBgn0001142 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_017451925.1 Gene:Lgsn / 316304 RGDID:727925 Length:565 Species:Rattus norvegicus


Alignment Length:320 Identity:69/320 - (21%)
Similarity:117/320 - (36%) Gaps:76/320 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NSDTTLKPRAIYRDPFKPGKNDVIVLCDTYSADGKPTASNKRAAFQAAIDLISDQEPWFGIEQEY 174
            |||..|.|...........:....|:|||::..|:|..::.|  :.|...|...|:..|.:...:
  Rat   200 NSDIVLMPELSTFRVLPWAERTARVICDTFTVTGEPLLTSPR--YIAKRQLRQLQDAGFSLLSAF 262

  Fly   175 TLLDVDGRPFGWPE------NGFPAPQGPYYCGVGADRVYARDLVEAHVVACLYAGIDFAGTNAE 233
            .   .|...||.||      ..|||..    .....|:.:.::||:         |:...|.|.|
  Rat   263 I---YDFCIFGVPEVINSKTISFPAST----LLSNHDQPFMQELVD---------GLYHTGANVE 311

  Fly   234 -----VMPAQWEFQIGPA-GIKACDDLWVSRYILQRIAEEYGVVVT-----------------FD 275
                 ..|.|.|....|. ||.:.|:.:..|..:|.:|..|..:.:                 :|
  Rat   312 SFSSSTRPGQMEICFLPEFGISSADNAFTLRTGVQEVARRYNYIASLVIETGFCNSGILSHSIWD 376

  Fly   276 PKPMEGQWN----GAGAHTNFSTKEMRADGGIK---AIEEAIEKLSKRHERHIKAYDPKEGKDNE 333
               :.|:.|    |:|......|.:....|.:|   |:...:.......:|:.|  |.::.||: 
  Rat   377 ---VSGKTNMFYSGSGVERLTLTGKKWLAGLLKHSAALSCLMAPAVNCRKRYCK--DSRDLKDS- 435

  Fly   334 RRLVGRLETSSIDKFSWGVANRAVSVRVPRGVATAGKG-YLEDRRPSSNCDPYAVCNAIV 392
                  :.|      :||..:.:.::.|.   ....|| .:|::..|:..:||.|..|.|
  Rat   436 ------VPT------TWGYNDNSCALNVK---CHGEKGTQIENKLGSATANPYLVLAATV 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1NP_001162839.1 PLN02284 54..398 CDD:177922 69/320 (22%)
Gln-synt_C 151..>385 CDD:278546 53/270 (20%)
LgsnXP_017451925.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0174
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.