DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gs1 and LOC100535016

DIOPT Version :9

Sequence 1:NP_001162839.1 Gene:Gs1 / 33172 FlyBaseID:FBgn0001142 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_017208420.1 Gene:LOC100535016 / 100535016 -ID:- Length:257 Species:Danio rerio


Alignment Length:158 Identity:60/158 - (37%)
Similarity:86/158 - (54%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SPNTALDKSILQRYRNLETPANRVQATYLWIDGTGENIRLKDRVLDKVPSSVEDLPDWQYDGSST 103
            |.::.|:|.:..||.|| ...:....||:|||..|.::..|.|.:|..|..:.|:|:|.. |..|
Zfish    93 SESSHLNKFLRHRYLNL-PQGDFCLVTYVWIDSCGVDLYSKTRTMDCEPKILADVPEWDV-GLET 155

  Fly   104 YQAHGENSDTTLKPRAIYRDPFKPGKNDVIVLCDTYSADGKPTASNKRAAFQAAIDLISDQEPWF 168
            .::   :|:..|....::||||..|.|. ::||:......||...|.|......::.:.|..|||
Zfish   156 EES---SSEMLLNHVRMFRDPFFLGPNK-LILCEVLKHTRKPAEWNHRNRCNTLMEKVKDLYPWF 216

  Fly   169 GIEQEYTLLDVDGRPFGWPENGFPAPQG 196
            |:|||||||.|||.|:.||..|||.|||
Zfish   217 GMEQEYTLLGVDGHPYSWPRLGFPKPQG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gs1NP_001162839.1 PLN02284 54..398 CDD:177922 55/143 (38%)
Gln-synt_C 151..>385 CDD:278546 25/46 (54%)
LOC100535016XP_017208420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D293770at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.