DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3164 and ABCG14

DIOPT Version :10

Sequence 1:NP_722605.1 Gene:CG3164 / 33171 FlyBaseID:FBgn0288229 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_564383.1 Gene:ABCG14 / 840064 AraportID:AT1G31770 Length:648 Species:Arabidopsis thaliana


Alignment Length:130 Identity:32/130 - (24%)
Similarity:55/130 - (42%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SFNAKERSEW--GGQALPQVAGGKPTVAAAPAGGDDDDDVDLFGSEDEEESAEAAKLKEERL-AA 122
            :|:.::||..  |.:.||....|..|..::...|..|.|:....:..|:.:      |..|| ||
plant   651 AFSKRQRSSLLAGAKGLPSSQKGGQTAESSDTSGVSDSDLSTTKNVKEDLN------KGNRLRAA 709

  Fly   123 YNAKKSKKPAL-------IAKSSIILDVKPWDDETDMKE----MEKNVRSIEMDGLLWGAAKLVP 176
            .:|...|||:.       .:.:|::.:|....::|...:    |.||  .:..:||..|...|.|
plant   710 VDAALRKKPSFGKNRVLEQSDASLVANVDSSSEKTLRNQLPSKMHKN--HVSHEGLQGGHPILWP 772

  Fly   177  176
            plant   773  772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3164NP_722605.1 3a01204 60..699 CDD:273361 32/130 (25%)
ABCG14NP_564383.1 PLN03211 10..646 CDD:215634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.