DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3164 and Abca4

DIOPT Version :9

Sequence 1:NP_722605.1 Gene:CG3164 / 33171 FlyBaseID:FBgn0025683 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001101191.1 Gene:Abca4 / 310836 RGDID:1309445 Length:2290 Species:Rattus norvegicus


Alignment Length:231 Identity:66/231 - (28%)
Similarity:110/231 - (47%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPAVDLAFHNLTYRVKEGNRSNAKTILKGVSGRLRSGELTAIMGPSGAGKSTLLNILSGYKTSSI 106
            |||||..  |:|:                     ...::||.:|.:||||:|.|:||:|....: 
  Rat   921 RPAVDRL--NITF---------------------YENQITAFLGHNGAGKTTTLSILTGLLPPT- 961

  Fly   107 EGSVTMNG--AERNLSAFRKLSAYIMQDNQLHGNLTVQEAMTVATNLK-LSKKFSKPEKHSMIDD 168
            .|:|.:.|  .|.:|.|.|:......|.|.|..:|||.|.:.....|| .|.:.::.|..:|::|
  Rat   962 SGTVLIGGKDIEISLDAVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEARLEMEAMLED 1026

  Fly   169 ILLTLSLSEHRYTMTRNLSGGQKKRLSIALELVSNPPIMFFDEPTSGLDSSTCFQCIHLLKMLAA 233
                ..|...|....::||||.:::||:|:..|.:..::..||||||:|..:......||....:
  Rat  1027 ----TGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRS 1087

  Fly   234 GGRTVICTIHQPSARLFEMFDQLYTLADGQCVYQGS 269
            |...::.|.|...|.|  :.|::..::.|:....|:
  Rat  1088 GRTIIMSTHHMDEADL--LGDRIAIISQGRLYCSGT 1121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3164NP_722605.1 ABCG_EPDR 44..268 CDD:213180 63/226 (28%)
3a01204 60..699 CDD:273361 59/213 (28%)
ABC2_membrane 431..630 CDD:279410
Abca4NP_001101191.1 rim_protein 1..2249 CDD:130324 66/231 (29%)
ABC_subfamily_A 907..1126 CDD:213230 66/231 (29%)
ABC_subfamily_A 1915..2135 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.