DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3164 and Abca2

DIOPT Version :9

Sequence 1:NP_722605.1 Gene:CG3164 / 33171 FlyBaseID:FBgn0025683 Length:699 Species:Drosophila melanogaster
Sequence 2:XP_006497672.1 Gene:Abca2 / 11305 MGIID:99606 Length:2464 Species:Mus musculus


Alignment Length:236 Identity:67/236 - (28%)
Similarity:117/236 - (49%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HLPKRPAVDLAFHNLTYRVKEGNRSNAKTILKGVSGRLRSGELTAIMGPSGAGKSTLLNILSG-Y 101
            |||....||        ::.:..:::.|..|..:|..|...::.:.:|.:||||:|.::||:| :
Mouse  1015 HLPLVVCVD--------KLTKVYKNDKKMALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLF 1071

  Fly   102 KTSSIEGSVTMNGAE--RNLSAFRKLSAYIMQDNQLHGNLTVQEAMTVATNLK-LSKKFSKPEKH 163
            ..:|  ||.|:.|.:  ..:...||......|.|.|...|||:|.:...:.|| ::::..:.|..
Mouse  1072 PPTS--GSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRKETD 1134

  Fly   164 SMIDDILLTLSLSEHRYTMTRNLSGGQKKRLSIALELVSNPPIMFFDEPTSGLDSSTCFQCIHLL 228
            .||:|    |.||..|:::.:.||||.|::||:|:..|.....:..||||:|:|.........|:
Mouse  1135 KMIED----LELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI 1195

  Fly   229 KMLAAGGRTVICTIHQPSARLFEMFDQLYTLADGQCVYQGS 269
            .....|...::.|.|...|.|  :.|::..::.|:....||
Mouse  1196 LKYKPGRTILLSTHHMDEADL--LGDRIAIISHGKLKCCGS 1234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3164NP_722605.1 ABCG_EPDR 44..268 CDD:213180 62/227 (27%)
3a01204 60..699 CDD:273361 62/214 (29%)
ABC2_membrane 431..630 CDD:279410
Abca2XP_006497672.1 rim_protein 58..2398 CDD:130324 67/236 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.