DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4822 and ARB1

DIOPT Version :9

Sequence 1:NP_001033861.1 Gene:CG4822 / 33170 FlyBaseID:FBgn0031220 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_010953.1 Gene:ARB1 / 856758 SGDID:S000000838 Length:610 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:69/268 - (25%)
Similarity:108/268 - (40%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QISSLQYSSD-INADSL----EPDQSEDFQTVLGLKYLPSWPAVNLQFSELCYVVPDQTNASKTK 73
            |..|.|...| :.||.|    .||:...|:    ...:...|...|.|.::.:    ...::.::
Yeast   352 QAKSRQKILDKMEADGLVQPVVPDKVFSFR----FPQVERLPPPVLAFDDISF----HYESNPSE 408

  Fly    74 TILRRVNGMFHSHELTAIIGPSGAGKTTLLNLLAGFGAVCESGEILVNNSPRDMRVFR----KMS 134
            .:...:|.........|::||:|.||:|||.::        :||:    :|:..||.|    |:.
Yeast   409 NLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIM--------TGEL----TPQSGRVSRHTHVKLG 461

  Fly   135 RYIMQT-DVLDSQFTVLEMMILAANLKLGKELNLKQKLEVIDEILGMLRLKDTLNTMAQ-KLSGG 197
            .|...: |.||...:.||.:       ..|..|:.|..:.....||...|.....|:.. .||.|
Yeast   462 VYSQHSQDQLDLTKSALEFV-------RDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEG 519

  Fly   198 ERKRLCIALELVNNPPVIFLDEPTTGLDDLSSSQCIALLKVLA------AGGRTVICSIHTPSAK 256
            :|.|:..||..:..|.|:.|||||.|||       |..:..||      .||..|:       :.
Yeast   520 QRSRVVFALLALEQPNVLLLDEPTNGLD-------IPTIDSLADAINEFNGGVVVV-------SH 570

  Fly   257 IFEMLDAV 264
            .|.:||.:
Yeast   571 DFRLLDKI 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4822NP_001033861.1 ABCG_EPDR 51..276 CDD:213180 58/226 (26%)
3a01204 67..654 CDD:273361 56/210 (27%)
ABC2_membrane 381..587 CDD:279410
ARB1NP_010953.1 Uup 79..601 CDD:223562 69/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.