DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4822 and Abca14

DIOPT Version :9

Sequence 1:NP_001033861.1 Gene:CG4822 / 33170 FlyBaseID:FBgn0031220 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_017167760.1 Gene:Abca14 / 67928 MGIID:2388708 Length:1719 Species:Mus musculus


Alignment Length:309 Identity:75/309 - (24%)
Similarity:135/309 - (43%) Gaps:48/309 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSDINADSLEPDQSEDFQTVLGLKYLPSWPAVN-----LQFSELCYVVPDQTNASKTKTILRRVN 80
            |.:::..|.|.|...:.:|:|.    ..|.::|     .:..::.:.:|       ....:|.::
Mouse  1362 SEELSGYSEEEDVQNERETILN----HPWRSLNSTVLIKELIKIYFKIP-------PTLAVRNIS 1415

  Fly    81 GMFHSHELTAIIGPSGAGKTTLLNLLAGFGAVCESGEILVN--NSPRDMRVFRKMSRYIMQTDVL 143
            ......|...::|.:||||||...:|.| ..:..||::.:.  :..|::...|....|..|.|.|
Mouse  1416 VAIQKEECFGLLGLNGAGKTTTFKILTG-EEIATSGDVFIEGYSITRNILKVRSKVGYCPQFDAL 1479

  Fly   144 DSQFTVLEMMILAANLKLGKELNLKQKLEVIDEILGMLRLKDTLNTMAQKLSGGERKRLCIALEL 208
            ....|..|::.:.|.:....|.:::   ..:|.:|.||.||...:.....||||.::||..|:.:
Mouse  1480 LDYMTSREILTMYARVWGIPENSIR---AYVDNLLKMLYLKPQADKFIYTLSGGNKRRLSTAIAI 1541

  Fly   209 VNNPPVIFLDEPTTGLDDLSSSQCIALLKVLAAGGRTVICSIHTPSAKIFEMLDA----VYVLAE 269
            :.|..|:|||||:||:|.|:.......:......|:.:|.:.|:     .|..:|    :.::.:
Mouse  1542 MGNSTVVFLDEPSTGMDPLARRMLWNAVIKTRESGKVIIITSHS-----MEECEALCTRLAIMVQ 1601

  Fly   270 GQCVYQGKGSNIVPFLKN-FGLCCPIT------------YNPADFIIEV 305
            |:.|..|...:    ||| ||....:|            .:..|||.||
Mouse  1602 GKFVCLGSPQH----LKNKFGNIYTMTIKFKTDTDDNTVQDLKDFIAEV 1646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4822NP_001033861.1 ABCG_EPDR 51..276 CDD:213180 56/235 (24%)
3a01204 67..654 CDD:273361 66/258 (26%)
ABC2_membrane 381..587 CDD:279410
Abca14XP_017167760.1 rim_protein <128..1709 CDD:130324 75/309 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.