DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nhe1 and SLC9B2

DIOPT Version :9

Sequence 1:NP_608491.3 Gene:Nhe1 / 33167 FlyBaseID:FBgn0026787 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001357130.1 Gene:SLC9B2 / 133308 HGNCID:25143 Length:537 Species:Homo sapiens


Alignment Length:403 Identity:80/403 - (19%)
Similarity:135/403 - (33%) Gaps:135/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ASTLVTDPPLIDSHAVEQEHNSSLSLFFVICVIMLGILLIHSML---QTGFQYLPESIVVVFLGA 140
            |..|:.:.|:|:.: |:.:|..|.||    ..|.|.|:|:.:.|   ....:.|....|.:.:|.
Human   152 AGFLIRNIPVINDN-VQIKHKWSSSL----RSIALSIILVRAGLGLDSKALKKLKGVCVRLSMGP 211

  Fly   141 FI------GLSLNVMSGQNGSWKREEVFSPMGFFL----------VLLPPIIF--ESGYNLHKGN 187
            .|      .|..:.:.|....|         ||.|          |::|.::.  ..||.:.|| 
Human   212 CIVEACTSALLAHYLLGLPWQW---------GFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKG- 266

  Fly   188 FFQNIGSILVFAIFGTTISALVIGAGIYLLGLGEVAFRLSFSESFAFGS--------LISAVDPV 244
                             :..|::.||.:...|....|......:|:.||        ::..|..|
Human   267 -----------------VPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTVFNVLRGVLEVVIGV 314

  Fly   245 AT-------VAIFHALDVDPIL---NMLVFGESILNDAISIVLTASITQSANVNAEASTGEAMFS 299
            ||       :..|.:.|.|.::   ..||.|.|:|                          |:||
Human   315 ATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVL--------------------------AVFS 353

  Fly   300 ALKTFCAMFFASAGIGVIFALISALLLKHIDLRKHPSLEFAMMLMFTYAPYVLAEGIHLSGIMAI 364
                  ::.|...|.|.:..|:.|               |...:.:|      :|...:..|:|:
Human   354 ------SVHFGFPGSGGLCTLVMA---------------FLAGMGWT------SEKAEVEKIIAV 391

  Fly   365 -------LFCGIVMSHYTHFNLSTVTQITMQQTMRTLAFIAETCVFAYLGLAIFSFKHQVELSFV 422
                   |..|::.:..:..:|...|......|:.....|.....|..:..|.|:.|.::.:||.
Human   392 AWDIFQPLLFGLIGAEVSIASLRPETVGLCVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFA 456

  Fly   423 IW---AIVLCLIG 432
             |   |.|...||
Human   457 -WLPKATVQAAIG 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nhe1NP_608491.3 NhaP 100..515 CDD:223104 74/382 (19%)
SLC9B2NP_001357130.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Na_H_Exchanger 176..537 CDD:351397 72/378 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.