DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11377 and CRELD2

DIOPT Version :9

Sequence 1:NP_608490.1 Gene:CG11377 / 33166 FlyBaseID:FBgn0031217 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_005261794.1 Gene:CRELD2 / 79174 HGNCID:28150 Length:403 Species:Homo sapiens


Alignment Length:349 Identity:126/349 - (36%)
Similarity:173/349 - (49%) Gaps:68/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PPPCRACTQLVSSFRAGL-ERTKRGHAGGDTAWEEEKLRSYKNSEVRLVEIQEKLCSEGEVINKD 91
            |.||..|..||..|..|: :..|:...||:|||||:.|..|::||:||:||.|.||...:.    
Human    28 PTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCESSDF---- 88

  Fly    92 HCHNLANEHEALLEDWFIHKQTESPDLQSWLCIDQLTVCCPLNTYGPDCLTC-----TECNGNGK 151
            .|:.:....|..||.|::..::|.|||..|.|:..|.|||...|||||||.|     ..|:|||.
Human    89 ECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGH 153

  Fly   152 CKGDGTRKGNGKCKCDPGYAGPNCNECGPEHYESFRDEKKLLCTQ-----------------C-- 197
            |.|||:|:|:|.|:|..||.||.|.:|...::.|.|:|...:||.                 |  
Human   154 CSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTAVRTGLSDSYPPCCLSLGCWR 218

  Fly   198 ---HA------------------------ACGEG--GCTGGGPKSCRKCKKGWSMDSEAGCVDIN 233
               ||                        ||.|.  .|:|...:.|.:|:.||.:| |..|||::
Human   219 GVGHAWIRGRNTHTQPGYSSRVWIAAFSPACDESCKTCSGLTNRDCGECEVGWVLD-EGACVDVD 282

  Fly   234 ECLEQQRPNPCRPQQFCVNNEGSFSCLECDRSCDGCDGDGPDMCRKCADGYELKEGKCHDIS--- 295
            ||..:  |.||...|||.|..||::|.|||.||.||.|:||..|::|..||..:.|:|.|:.   
Human   283 ECAAE--PPPCSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISGYAREHGQCADVDECS 345

  Fly   296 -AEQ---RSNYVSFTRMLTYFGMC 315
             ||:   |.|...:....:|..:|
Human   346 LAEKTCVRKNENCYNTPGSYVCVC 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11377NP_608490.1 DUF3456 31..123 CDD:288766 35/92 (38%)
EGF_CA 231..>259 CDD:214542 12/27 (44%)
FU 258..293 CDD:214589 17/34 (50%)
CRELD2XP_005261794.1 DUF3456 31..120 CDD:371810 35/92 (38%)
FU 247..280 CDD:214589 12/33 (36%)
FU 305..345 CDD:214589 18/39 (46%)
vWFA <338..378 CDD:381780 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3406
eggNOG 1 0.900 - - E1_KOG4260
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11526
Inparanoid 1 1.050 269 1.000 Inparanoid score I3022
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45808
OrthoDB 1 1.010 - - D378427at33208
OrthoFinder 1 1.000 - - FOG0002526
OrthoInspector 1 1.000 - - otm41471
orthoMCL 1 0.900 - - OOG6_105894
Panther 1 1.100 - - LDO PTHR24034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1897
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.