DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11377 and LOC100003741

DIOPT Version :9

Sequence 1:NP_608490.1 Gene:CG11377 / 33166 FlyBaseID:FBgn0031217 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_009304516.1 Gene:LOC100003741 / 100003741 -ID:- Length:234 Species:Danio rerio


Alignment Length:257 Identity:68/257 - (26%)
Similarity:101/257 - (39%) Gaps:74/257 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LTVCCPLNTYGPDCLTCTECNGNGKCKGDGTRKGNGKCKCDPGY------------AGPNCNECG 179
            |:|.....|:|.:|        :..||..|..:.|...:|..|:            .|.:.::| 
Zfish    11 LSVALSHLTWGQNC--------SDHCKACGGPENNQCLQCQTGFILHDNLCVDIDECGTDLDQC- 66

  Fly   180 PEHYESFRDEKKLLCTQCHAACGEGGCTGGGPKSCRKCKKGWSMDSEAGCVDINECLEQQRPNPC 244
            |.:...|.......|..|..||  .||.|||...|:||..|: ..|...|:|::||.|:..  .|
Zfish    67 PHNTYCFNTRGSYECKGCDKAC--VGCMGGGAARCKKCAPGY-RSSGLRCMDVDECGEEVL--AC 126

  Fly   245 RP-QQFCVNNEGSFSCLECDRSCDGCDGDGPDMCRKCADGYELKEGKCH----DISAE------- 297
            .. ..||||.||||.|                   :||:|:..:|..|.    ..|||       
Zfish   127 AGLNVFCVNTEGSFQC-------------------QCAEGFTRREQNCERQQTSASAEKGLFDDI 172

  Fly   298 QRSNYVSFTRMLTYFGMCVATCVIFQSSTHIAWGCIV------GAAVAGYIAVSEYWINSEA 353
            |....:...:|  :||  |..|.:   :|..|.|.:|      |||.    |::.||::.::
Zfish   173 QEDELMVLQQM--FFG--VVLCAL---ATLAAKGDLVFTSIFMGAAA----AMAGYWLSDKS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11377NP_608490.1 DUF3456 31..123 CDD:288766
EGF_CA 231..>259 CDD:214542 13/28 (46%)
FU 258..293 CDD:214589 6/38 (16%)
LOC100003741XP_009304516.1 FU 24..>71 CDD:238021 10/55 (18%)
vWFA <113..154 CDD:294047 19/61 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378427at33208
OrthoFinder 1 1.000 - - FOG0002526
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.