DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals3

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_114020.1 Gene:Lgals3 / 83781 RGDID:69356 Length:262 Species:Rattus norvegicus


Alignment Length:134 Identity:36/134 - (26%)
Similarity:57/134 - (42%) Gaps:20/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PRPG-----LCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQN---YITRNSRL 97
            |.||     :.....|.:........::|  |:|:      |:......|..:|   .|..|::.
  Rat   133 PLPGGVMPRMLITIIGTVKPNANSITLNF--KKGN------DIAFHFNPRFNENNRRVIVCNTKQ 189

  Fly    98 KGKWGPEENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVS 162
            ...||.||..|  .|....||.|.:|:|:..:.|.::||..|..:|.|||  :.|..:..||.:.
  Rat   190 DNNWGREERQS--AFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRM--KNLREISQLGIIG 250

  Fly   163 DIVI 166
            ||.:
  Rat   251 DITL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 34/128 (27%)
Gal-bind_lectin 226..369 CDD:278752
Lgals3NP_114020.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102
Bindin 18..>116 CDD:251078
9 X 9 AA tandem repeats of Y-P-G-X(3)-P-[GS]-[AG] 35..112
GLECT 129..256 CDD:238025 36/134 (27%)
Beta-galactoside binding. /evidence=ECO:0000250 193..199 4/5 (80%)
Nuclear export signal. /evidence=ECO:0000250 238..253 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7884
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.