DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and si:dkey-95h12.1

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_001334297.2 Gene:si:dkey-95h12.1 / 794350 ZFINID:ZDB-GENE-060503-85 Length:754 Species:Danio rerio


Alignment Length:129 Identity:35/129 - (27%)
Similarity:56/129 - (43%) Gaps:8/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEENSSY 109
            :....:|.:......||:|.  .:|.:|.  |.|.... |......|..||.:...||.||. ..
Zfish   632 MIITINGKVNADANQFVVDL--SKGPDIA--CHVNFSF-SEDGNPRIGCNSLIGSIWGKEER-GV 690

  Fly   110 LTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVSDIVIDTYYVSE 173
            .:|...||..|.|:||.|...|.::|||.|...:.||:  :.|:.:..:|...|:.:.:..|.:
Zfish   691 SSFHFFRGMPFEMKILCTNTEFQVTVNGSHLMNFKHRI--QELDQIRGIGIYRDVTLSSLNVGK 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 33/116 (28%)
Gal-bind_lectin 226..369 CDD:278752
si:dkey-95h12.1XP_001334297.2 FN3 501..592 CDD:238020
Gal-bind_lectin 626..749 CDD:214904 34/124 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9258
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.