DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and LGALS14

DIOPT Version :10

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_982297.1 Gene:LGALS14 / 56891 HGNCID:30054 Length:168 Species:Homo sapiens


Alignment Length:125 Identity:34/125 - (27%)
Similarity:54/125 - (43%) Gaps:16/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GLCFVFHGMILMACEHFV------IDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWG 102
            |.|.:..|..::.   ||      ::|.|  |.:  |:.|:..|.........| .||.:.|.|.
Human    46 GSCVIITGTPILT---FVKDPQLEVNFYT--GMD--EDSDIAFQFRLHFGHPAI-MNSCVFGIWR 102

  Fly   103 PEENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVS 162
            .||...||.|:  .||.|.:.|.:..:.:.:.|||.....:.||.|...::.:.|..|:|
Human   103 YEEKCYYLPFE--DGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDIS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 42..162 CDD:459768 33/123 (27%)
Gal-bind_lectin 237..367 CDD:459768
LGALS14NP_982297.1 Gal-bind_lectin 40..165 CDD:459768 34/125 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.