DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals12

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001343503.1 Gene:Lgals12 / 56072 MGIID:1929094 Length:314 Species:Mus musculus


Alignment Length:190 Identity:48/190 - (25%)
Similarity:85/190 - (44%) Gaps:27/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 FLYQPSL--PLPFYGKLLKENFLIEGSSLRIEGRVRLMPQRFSIAFQKGQEIWPQPTVSFYFSPC 279
            |:.||.:  |:..||..:... |..|..:.::|.|.|..:||.:.||.|..:.|||.|:|.|||.
Mouse    14 FILQPPVFHPVIPYGTTIFGG-LYAGKMVTLQGVVPLHARRFQVDFQCGCCLHPQPDVAFRFSPR 77

  Fly   280 FLRSR-HDKIGTAIITRRAYLNGDWVNCTVSRLNTSLRPGGAFVIVIACRDSYYELFVNNRSLFH 343
            |...: |       :....:..|.|.. .:.....:|:.|.:|:|:....:...::.||.:...|
Mouse    78 FYTVKPH-------VICNTHQGGLWQK-EIRWPGVALQRGDSFLILFLFENEEVKVSVNGQHFLH 134

  Fly   344 FKYQMRPECVDIVNIRGDIKLWEVA-------IQGNTTYK--------KPKVRSAMERAI 388
            ::|::....||.::|.|||.:..|.       ::|:..|.        .|::.....||:
Mouse   135 YRYRLPLSRVDTLDISGDILVKAVGFLNINPFVEGSREYPVGYPFLLYSPRLEVPCSRAL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752
Gal-bind_lectin 226..369 CDD:278752 39/150 (26%)
Lgals12NP_001343503.1 Gal-bind_lectin 26..158 CDD:366037 38/140 (27%)
Gal-bind_lectin 195..313 CDD:214904 48/190 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840837
Domainoid 1 1.000 54 1.000 Domainoid score I11154
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S7663
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.