DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals8

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001277984.1 Gene:Lgals8 / 56048 MGIID:1928481 Length:325 Species:Mus musculus


Alignment Length:340 Identity:71/340 - (20%)
Similarity:144/340 - (42%) Gaps:58/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQ-NYITRNSRLKGKWGPEE 105
            :||...|..|.:....|.|.:||  :.|:.:....||......|..: :.|..|:..:.|||.||
Mouse    27 KPGSLIVIRGHVPKDSERFQVDF--QLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEE 89

  Fly   106 NSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVSDIVIDTYY 170
            .:..:.|:  :.|||.:..::.:..|.::|||.|...|.||:....::.|.:.|.|:        
Mouse    90 ITYDMPFR--KEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVN-------- 144

  Fly   171 VSEYPIRLTHSLPRPIPHSNKLPR---DGENVETEWMVLSSLAKMSSKKFLYQP---SLPLPFYG 229
                    .||:......::.||.   |.:::||..:.|:.:    :::.:.:|   .|.|||..
Mouse   145 --------IHSIGFRFSSASALPHTLGDLQSMETSALGLTQI----NRENIQKPGKLQLSLPFEA 197

  Fly   230 KLLKENFLIEGSSLRIEGRVRLMPQRFSIAFQKGQEIWPQPTVSFYFSPCFLRSRHDKIGTAIIT 294
            :|  ...:..|.::.|:|.|....:.|::....|:    ...::.:.:|        ::......
Mouse   198 RL--NASMGPGRTVVIKGEVNTNARSFNVDLVAGK----TRDIALHLNP--------RLNVKAFV 248

  Fly   295 RRAYLNGDW------VNCTVSRLNTSLRPGGAFVIVIACRDSYYELFVNNRSLFHFKYQMRP-EC 352
            |.::|...|      :.|      .....|..|.::|.|....:::.:|......:|::.:. ..
Mouse   249 RNSFLQDAWGEEERNITC------FPFSSGMYFEMIIYCDVREFKVAINGVHSLEYKHRFKDLSS 307

  Fly   353 VDIVNIRGDIKLWEV 367
            :|.:::.|||:|.:|
Mouse   308 IDTLSVDGDIRLLDV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 33/120 (28%)
Gal-bind_lectin 226..369 CDD:278752 26/149 (17%)
Lgals8NP_001277984.1 Gal-bind_lectin 24..148 CDD:214904 35/140 (25%)
Gal-bind_lectin 203..322 CDD:214904 22/136 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11154
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4628
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm8697
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.