DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lgals3a

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001373725.1 Gene:lgals3a / 557373 ZFINID:ZDB-GENE-030131-7667 Length:368 Species:Danio rerio


Alignment Length:125 Identity:36/125 - (28%)
Similarity:60/125 - (48%) Gaps:18/125 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEENS 107
            |.|.....|..::..:.|.:||:  :|.|      |:.....|..:|.:.|||:|.|.|||||..
Zfish   249 PHLLITIVGEPIIGGDRFHVDFM--RGHE------VVFHFNPRFHENTVVRNSQLGGLWGPEERE 305

  Fly   108 SYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVSDIVID 167
            .  .|...:|:.|.::||:..:.|.::|:|.|..::.||        ...:.||:.:.||
Zfish   306 G--GFPFVQGRQFELKILVETDGFKVAVDGVHLLEFEHR--------TGGMEDVTRLRID 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 33/118 (28%)
Gal-bind_lectin 226..369 CDD:278752
lgals3aNP_001373725.1 PRK07764 <11..158 CDD:236090
Gal-bind_lectin 246..362 CDD:214904 36/125 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9258
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.