DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lgals9l4

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001034900.1 Gene:lgals9l4 / 556717 ZFINID:ZDB-GENE-060312-19 Length:281 Species:Danio rerio


Alignment Length:326 Identity:74/326 - (22%)
Similarity:133/326 - (40%) Gaps:82/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GLCFVFHGMILMACEHFVIDF--LTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEEN 106
            |...:..|.:|...:.|.::.  ..|.|::|.........:|..    :|..|:..||.|||||.
Zfish    27 GKTLIIIGRVLPNADIFGVNLQHAAKCGTDIALHFKPCFDVGPA----HIVFNTFEKGNWGPEEK 87

  Fly   107 SSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVSDIVIDTYYV 171
            |   |....:|:.|.::|.:|:|.:.:||||.|.|.|.||:|:              .::||..|
Zfish    88 S---TCPFVKGQPFTLEIHVTKEAYKVSVNGQHLADYKHRIPF--------------TLVDTILV 135

  Fly   172 SEYPIRLTHSLPRPIPHSNKLPRDGENVETEWMVLSSLAKMSSKKFLYQPSLPLPFYGKLLKENF 236
               |:.                     ||.:::.             ||..:.:|:  |.|..:.
Zfish   136 ---PLM---------------------VELDFIA-------------YQKPVTVPY--KTLISDG 161

  Fly   237 LIEGSSLRIEGRVRLMPQR--FSIAFQKGQEIWPQPTVSFYFSPCFLRSRHDKIGTAIITRRAYL 299
            |..|..:.|.|..:....|  |::..:.|        ::|::     :.|.|:  .|:: |..:.
Zfish   162 LQSGKDIVIHGVPKADSDRMTFNLRHRYG--------IAFHY-----QCRFDQ--NAVV-RNTWE 210

  Fly   300 NGDWVNCTVSRLNTSLRPGGAFVIVIACRDSYYELFVNNRSLFHFKYQMRP-ECVDIVNIRGDIK 363
            ||.| .............|..|.:.|:|...:|::|||.:....:|::... |.:|:..|||:::
Zfish   211 NGKW-GAEEKHGPVPFIRGQFFQVKISCHSDHYDVFVNGKQTHIYKHRFTELEDIDVFEIRGNVE 274

  Fly   364 L 364
            :
Zfish   275 V 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 34/119 (29%)
Gal-bind_lectin 226..369 CDD:278752 32/142 (23%)
lgals9l4NP_001034900.1 Gal-bind_lectin 22..144 CDD:214904 40/161 (25%)
Gal-bind_lectin 161..279 CDD:214904 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8031
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4720
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm6433
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.