DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lgals2a

DIOPT Version :10

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_998059.2 Gene:lgals2a / 405830 ZFINID:ZDB-GENE-050318-2 Length:134 Species:Danio rerio


Alignment Length:84 Identity:22/84 - (26%)
Similarity:32/84 - (38%) Gaps:17/84 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DVLLQIGSRL----PQNYITRNSRLKGKWGPEENSSYLTFQLNRGKSFWMQILLTEECFFISV-- 135
            |:.|.:..|.    .|..|..||...|.|..|...:  .|...:.|.|.::|..|.|.|.:::  
Zfish    40 DIALHMNPRFDAHGDQCTIVCNSFQSGSWCEEHRDN--NFPFIQDKEFQIKITFTNEEFLVTLPD 102

  Fly   136 -NGYHFA--------KYFH 145
             :..||.        ||.|
Zfish   103 GSEIHFPNRQGSEKYKYMH 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 42..162 CDD:459768 22/84 (26%)
Gal-bind_lectin 237..367 CDD:459768
lgals2aNP_998059.2 GLECT 10..132 CDD:238025 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.