DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and GRIFIN

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001381716.1 Gene:GRIFIN / 402635 HGNCID:4577 Length:144 Species:Homo sapiens


Alignment Length:91 Identity:24/91 - (26%)
Similarity:38/91 - (41%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEENS 107
            ||...:..|......:.|..:||.:.|       |:...|..|.....:..|:...|:||||:.|
Human    15 PGWKLLVQGHADSGEDRFETNFLLETG-------DIAFHIKPRFSSATVVGNAFQYGRWGPEQVS 72

  Fly   108 SYLTFQLNRGKSFWMQILLTEECFFI 133
            |  .|.|..|:.|.:::....|.|.:
Human    73 S--IFPLAPGEPFEIEVSWDAEHFHV 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 24/91 (26%)
Gal-bind_lectin 226..369 CDD:278752
GRIFINNP_001381716.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.