DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Pex23

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_730508.1 Gene:Pex23 / 40229 FlyBaseID:FBgn0052226 Length:1350 Species:Drosophila melanogaster


Alignment Length:433 Identity:80/433 - (18%)
Similarity:139/433 - (32%) Gaps:136/433 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEENS-SYLTFQLNRGKSFWMQILLTEECFF 132
            ||:...||.:|   .|.:....:|.::.....|..|:.| |.:....|..|....::...:|...
  Fly   566 GSQFWTECGIL---WSCVASGAVTVDASNMPNWFNEQTSDSKVDVNANWRKDIVNKLQRRQEKLA 627

  Fly   133 ISVNGYHFAKYFHRMPYRWLEAVDVL-----GDVSDIVIDTYYVS-------------------- 172
            .......|.|.....  .|:::.|..     |:..|.:|:..:||                    
  Fly   628 KLQTVAKFEKAVELS--SWVKSADARYQRPGGEFEDCIIELEWVSSGSGTDTNSSENSRSGDSGT 690

  Fly   173 -------------EYPIR-LT-------HSLPRPIPHSNKLPRDGENVE---------TEWM--- 204
                         ::|:. :|       ...||...|:..||.:...|:         .:|:   
  Fly   691 FTVLSPDGAATKIQFPLSDITCVQCCSEAGAPRIAIHAPHLPVNCSPVKLQFSSDSEMEDWLSHL 755

  Fly   205 --VLSSLAKMSSKK--------------FLYQP----------------------SLPLPFYGKL 231
              |.|.:..|..|.              |::.|                      :...|:|..|
  Fly   756 SSVCSQINTMVGKPAGNAIWITSELGDVFVFDPANMKAHQTSEPSEGYVEKMDVSTCETPYYNTL 820

  Fly   232 LKENFLIEGSSLRIEGRVRLMPQRFSIAFQKGQEIWPQP-------TVSFYFSPCFLRSRHDKIG 289
            .  |.:..|:.|.|.|.|.....:.....|....:..||       .::.:.:|.|..       
  Fly   821 Y--NGMPCGTELEISGCVYDDADQIRFDLQSHSAVKVQPHRVEKHRVIALHLNPRFNE------- 876

  Fly   290 TAIITRRAYLN----GDWVNCTVSRLNTSLRPGGAFVIVIACRDSYYELFVNNRSLFHFKYQMRP 350
                 |...||    .:|:: .:.....:..||..|.:.|.....:|.:.|||.....:||::.|
  Fly   877 -----RTTVLNSMKESEWLD-EIRNDKMAFAPGATFSLKIRALQDHYLIIVNNAVYTDYKYRIDP 935

  Fly   351 ECVDIVNIRGDIKLWEVAIQGNTTYKKPKVRSAMERAISAWKR 393
            |.|..:.:.|.|||:      |..|:.|.:..:|||  ..|::
  Fly   936 ESVTRLYVSGRIKLF------NVLYRCPSLIVSMER--MHWRQ 970

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 19/98 (19%)
Gal-bind_lectin 226..369 CDD:278752 35/153 (23%)
Pex23NP_730508.1 DysFN 64..125 CDD:214777
Hyd_WA 210..238 CDD:283993
Hyd_WA 257..282 CDD:283993
TECPR 280..320 CDD:214782
TECPR 338..371 CDD:214782
PH-like 639..759 CDD:302622 16/121 (13%)
Gal-bind_lectin 815..954 CDD:278752 36/159 (23%)
TECPR 966..1000 CDD:214782 1/5 (20%)
DysFN 1021..1081 CDD:214777
DysFC 1092..>1113 CDD:128935
Hyd_WA 1165..1192 CDD:283993
Hyd_WA 1209..1237 CDD:283993
Hyd_WA 1308..1333 CDD:283993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.