DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and LGALS8

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_006490.3 Gene:LGALS8 / 3964 HGNCID:6569 Length:359 Species:Homo sapiens


Alignment Length:360 Identity:81/360 - (22%)
Similarity:140/360 - (38%) Gaps:67/360 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQ-NYITRNSRLKGKWGPEEN 106
            ||...|..|.:....:.|.:|.  :.||.:....||......|..: ..|..|:.:..|||.|| 
Human    29 PGTLIVIRGHVPSDADRFQVDL--QNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREE- 90

  Fly   107 SSYLTFQ--LNRGKSFWMQILLTEECFFISVNGYHFAKYFHRM-PYRWLEAVDVLGDVSDIVI-- 166
               :|:.  ..|.|||.:.|::.::.|.::|||.|...|.||: |    |.:|.||....:.|  
Human    91 ---ITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGP----EKIDTLGIYGKVNIHS 148

  Fly   167 -------DTYYVSEYPIRLTHSLPRPIPHSN--KLP--RDGENVETEWMVLSSLAKMS----SKK 216
                   |........:.||......:|.|.  :||  |.|:        :|.:|..:    ||.
Human   149 IGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLPSNRGGD--------ISKIAPRTVYTKSKD 205

  Fly   217 FLYQPSLP-------------LPFYGKLLKENFLIEGSSLRIEGRVRLMPQRFSIAFQKGQEIWP 268
            .....:|.             |||..:|  ...:..|.::.::|.|....:.|::....|:    
Human   206 STVNHTLTCTKIPPMNYVSKRLPFAARL--NTPMGPGRTVVVKGEVNANAKSFNVDLLAGK---- 264

  Fly   269 QPTVSFYFSPCFLRSRHDKIGTAIITRRAYLNGDWVNCTVSRLNTSLRPGGAFVIVIACRDSYYE 333
            ...::.:.:|        ::......|.::|...|.....:..:....||..|.::|.|....::
Human   265 SKDIALHLNP--------RLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFK 321

  Fly   334 LFVNNRSLFHFKYQMRP-ECVDIVNIRGDIKLWEV 367
            :.||......:|::.:. ..:|.:.|.|||.|.||
Human   322 VAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 37/122 (30%)
Gal-bind_lectin 226..369 CDD:278752 28/143 (20%)
LGALS8NP_006490.3 Gal-bind_lectin 18..151 CDD:278752 38/131 (29%)
Gal-bind_lectin 236..356 CDD:214904 23/131 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8848
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4712
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm8457
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.