DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and LGALS7

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_002298.1 Gene:LGALS7 / 3963 HGNCID:6568 Length:136 Species:Homo sapiens


Alignment Length:122 Identity:36/122 - (29%)
Similarity:57/122 - (46%) Gaps:10/122 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPGLCFVFHGMILMACEHFVIDFL--TKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPE 104
            |||......|::......|.::.|  .:|||      |..|....||..:.:..||:.:|.||.|
Human    15 RPGTVLRIRGLVPPNASRFHVNLLCGEEQGS------DAALHFNPRLDTSEVVFNSKEQGSWGRE 73

  Fly   105 ENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDV 161
            |....:.||  ||:.|.:.|:.:::.|...|....:..:.||:|...:..|:|.|||
Human    74 ERGPGVPFQ--RGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 36/122 (30%)
Gal-bind_lectin 226..369 CDD:278752
LGALS7NP_002298.1 Gal-bind_lectin 11..133 CDD:214904 36/122 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.