DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and LGALS3

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001344607.1 Gene:LGALS3 / 3958 HGNCID:6563 Length:264 Species:Homo sapiens


Alignment Length:132 Identity:37/132 - (28%)
Similarity:57/132 - (43%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PRPG-----LCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQN---YITRNSRL 97
            |.||     :.....|.:........:||  ::|:      ||......|..:|   .|..|::|
Human   135 PLPGGVVPRMLITILGTVKPNANRIALDF--QRGN------DVAFHFNPRFNENNRRVIVCNTKL 191

  Fly    98 KGKWGPEENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVS 162
            ...||.||..|...|:  .||.|.:|:|:..:.|.::||..|..:|.||:  :.|..:..||...
Human   192 DNNWGREERQSVFPFE--SGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRV--KKLNEISKLGISG 252

  Fly   163 DI 164
            ||
Human   253 DI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 35/128 (27%)
Gal-bind_lectin 226..369 CDD:278752
LGALS3NP_001344607.1 DNA_pol3_gamma3 <23..127 CDD:331207
GLECT 131..258 CDD:238025 37/132 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8601
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.