DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and CG5335

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_611349.2 Gene:CG5335 / 37140 FlyBaseID:FBgn0034365 Length:321 Species:Drosophila melanogaster


Alignment Length:135 Identity:35/135 - (25%)
Similarity:61/135 - (45%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEE----NSSYLTFQLNRGKSF 120
            |.|:..|.: |.:....|:.|:.......:.|.||||:.|.||.||    :.:.|...:..|:.|
  Fly    32 FHINLCTAK-STVDPNADIGLRFSCYFRNDVIVRNSRINGAWGEEESHVMDPNTLPNPIVSGEFF 95

  Fly   121 WMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVSDIVIDTYYVSEYPIRLTHSLPRP 185
            .:.||..|:.|.||:|...|.::.:|||...:.|:::...:.       .:.:...|.....|.|
  Fly    96 LVYILCCEDSFAISINSREFCRFRYRMPLGTIRALEIRDQIQ-------VIKQVDHRTVFPNPWP 153

  Fly   186 IPHSN 190
            ..|::
  Fly   154 AVHAS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 31/105 (30%)
Gal-bind_lectin 226..369 CDD:278752
CG5335NP_611349.2 Gal-bind_lectin 5..140 CDD:278752 31/115 (27%)
GLECT 172..297 CDD:238025
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - otm14067
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
76.920

Return to query results.
Submit another query.