DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lgalslb

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001007175.1 Gene:lgalslb / 368889 ZFINID:ZDB-GENE-030616-570 Length:145 Species:Danio rerio


Alignment Length:152 Identity:37/152 - (24%)
Similarity:67/152 - (44%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AHRRKHFKVIQCPRPGLCFVFHGMILMACE--HFVIDFLTKQGSEICEEC------------DVL 79
            :||...|.|      |:|.|    .|.:|.  |.|::.......:|...|            ||.
Zfish     3 SHRTNTFYV------GICSV----ALHSCNFVHTVLNVGFLHSFDISLTCGHNEEKEDEKLADVA 57

  Fly    80 LQIGSRLPQNYITRNSRLKGKWGPEENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYF 144
            |::.:|..:....||:|:.|||. ||.:....|.....:.|.::|....:.|.|.|:|:....::
Zfish    58 LKLSARFTERQFLRNARVSGKWS-EEEAPIAYFPFIPDQPFRIEIHCEHQRFRIFVDGHQLFDFY 121

  Fly   145 HRMPYRWLEAVDVLGDVSDIVI 166
            |::  :.|:|::::..|..:.|
Zfish   122 HKV--KSLQAINMIRIVGSLQI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 32/138 (23%)
Gal-bind_lectin 226..369 CDD:278752
lgalslbNP_001007175.1 Gal-bind_lectin 34..143 CDD:214904 26/111 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.