DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgalsl

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001128202.1 Gene:Lgalsl / 360983 RGDID:1307414 Length:172 Species:Rattus norvegicus


Alignment Length:153 Identity:33/153 - (21%)
Similarity:63/153 - (41%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LYQPSLPLPFYGKLLKENFLIEGSSLRIEGRVRLMPQRFSIAFQKGQEIWPQPTVSFYFSPCFLR 282
            :|.|.|.:||.|.:  :..:..|..:.:.|.|.|.|:.|:|:...|....|...|:....     
  Rat    31 VYFPRLIVPFCGHI--KGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELK----- 88

  Fly   283 SRHDKIGTAIITRRAYLNGDWVNCTVSRLNTSLR-----PGGAFVIVIACRDSYYELFVNNRSLF 342
                    |:.|.|..|....::.......:::.     |...|.:.|.|....:.:||:...||
  Rat    89 --------AVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLF 145

  Fly   343 HFKYQMRP-ECVDIVNIRGDIKL 364
            .|.::::. ..:|.:.|.||:::
  Rat   146 DFYHRIQTLSAIDTIKINGDLQI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752
Gal-bind_lectin 226..369 CDD:278752 30/145 (21%)
LgalslNP_001128202.1 Gal-bind_lectin 46..170 CDD:214904 27/136 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.