DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals7

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_072104.2 Gene:Lgals7 / 29518 RGDID:61951 Length:136 Species:Rattus norvegicus


Alignment Length:120 Identity:38/120 - (31%)
Similarity:59/120 - (49%) Gaps:6/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEEN 106
            |.|......|::......|.::.|.  |.|  :|.|..|....||..:.:..|::.:||||.||.
  Rat    15 RLGTVMRIRGVVPDQAGRFHVNLLC--GEE--QEADAALHFNPRLDTSEVVFNTKQQGKWGREER 75

  Fly   107 SSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDV 161
            .:.:.||  ||:.|.:.|:.|||.|...:....:..:.||||...:.:|:|.|||
  Rat    76 GTGIPFQ--RGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVRSVEVGGDV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 38/120 (32%)
Gal-bind_lectin 226..369 CDD:278752
Lgals7NP_072104.2 Gal-bind_lectin 5..135 CDD:395266 38/120 (32%)
Beta-galactoside binding. /evidence=ECO:0000255 70..76 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.