DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals12

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001099803.1 Gene:Lgals12 / 293710 RGDID:1306914 Length:314 Species:Rattus norvegicus


Alignment Length:296 Identity:69/296 - (23%)
Similarity:99/296 - (33%) Gaps:110/296 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HRRKHFKVIQC-----PRPGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQN 89
            |.|:.....||     |||.:.|           ||...|.|.:...||                
  Rat    50 HARRFQVDFQCGCCLHPRPDVAF-----------HFSPRFYTVKPHVIC---------------- 87

  Fly    90 YITRNSRLKGKWGPEENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEA 154
                |:...|.|  ::...:....|.:|.||.:..|...|...:||||.||..|.:|:|...::.
  Rat    88 ----NTLQGGLW--QKEVRWPGIALQKGASFLILFLFDNEEVKVSVNGQHFLHYRYRLPLSRVDT 146

  Fly   155 VDVLGDVSDIVIDTYYVS-------EYPI---RLTHSLPRPIPHSNKLPR---DGENVETEWMVL 206
            :|:.||:....:....:|       |||:   .|.:|....:|.|..|||   .|:.:....:||
  Rat   147 LDISGDILVKAVGFLNISPFVEGSREYPVGYPLLLYSPRLEVPCSRALPRGLWPGQVIVVRGLVL 211

  Fly   207 S---------------------------SLAKMSS---KKFLYQPSLPLPFYGKLLKENFLI--E 239
            .                           :||.:||   ||.:   |.|..||.:...|..|:  |
  Rat   212 KEPKDFTLSLRDGATHVPVTLRASFTDRTLAWVSSWGRKKLI---SAPFLFYPQRFFEVLLLCQE 273

  Fly   240 GS------------------------SLRIEGRVRL 251
            |.                        .|||.|.|.|
  Rat   274 GGLKLALNGHGLGATSLDQKALEQLRDLRISGSVHL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 33/129 (26%)
Gal-bind_lectin 226..369 CDD:278752 12/52 (23%)
Lgals12NP_001099803.1 Gal-bind_lectin 26..160 CDD:395266 35/142 (25%)
Gal-bind_lectin 195..313 CDD:214904 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344250
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.