DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals5

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_037108.1 Gene:Lgals5 / 25475 RGDID:3004 Length:145 Species:Rattus norvegicus


Alignment Length:129 Identity:36/129 - (27%)
Similarity:61/129 - (47%) Gaps:13/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PGLCFVFHGMILMACEHFVIDFLTKQGSEICEEC--DVLLQIGSRLPQNYITRNSRLKGKWGPEE 105
            |....|..|::|...:.|.|:.          .|  |:...:..|..:|.:.||:::...|||||
  Rat    27 PSKSIVISGVVLSDAKRFQINL----------RCGGDIAFHLNPRFDENAVVRNTQINNSWGPEE 81

  Fly   106 NSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHR-MPYRWLEAVDVLGDVSDIVIDT 168
            .|...:...:||:.|.:.||....||.::|:|.|..:|.|| |....:..::|.||:....::|
  Rat    82 RSLPGSMPFSRGQRFSVWILCEGHCFKVAVDGQHICEYSHRLMNLPDINTLEVAGDIQLTHVET 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 35/121 (29%)
Gal-bind_lectin 226..369 CDD:278752
Lgals5NP_037108.1 Gal-bind_lectin 22..144 CDD:214904 35/126 (28%)
Beta-galactoside binding. /evidence=ECO:0000255 77..83 5/5 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7884
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm8932
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.