DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lec-7

DIOPT Version :10

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001379074.1 Gene:lec-7 / 181199 WormBaseID:WBGene00002270 Length:179 Species:Caenorhabditis elegans


Alignment Length:98 Identity:27/98 - (27%)
Similarity:50/98 - (51%) Gaps:8/98 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QNYITRNSRLKGKWGPEENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWL 152
            ::.|..||.:.|:|||:...|:.   |.|...|.::|.:.|..:.|:||.....::.||.|...:
 Worm    60 EHSIVLNSLINGEWGPQLRHSHF---LKRHDPFHVRIYVHEGYYNITVNSDLLVEFDHRFPVVAV 121

  Fly   153 EAVDVLG--DVSDIVIDTY-YVSEYPIRLTHSL 182
            :.:.:.|  |:..||...| :.:|:..|  |::
 Worm   122 QGIGIKGSVDIESIVFKGYEFKTEWKKR--HAI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 42..162 CDD:459768 21/75 (28%)
Gal-bind_lectin 237..367 CDD:459768
lec-7NP_001379074.1 GLECT 15..137 CDD:214596 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.