DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lec-11

DIOPT Version :10

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001023191.1 Gene:lec-11 / 177420 WormBaseID:WBGene00002274 Length:232 Species:Caenorhabditis elegans


Alignment Length:132 Identity:37/132 - (28%)
Similarity:56/132 - (42%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HFKVIQCPRPGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRL---PQNYITRNS 95
            |.:|.|.|:.|               |.::|.||.|        |.|.|..|:   .||.|..|.
 Worm    29 HGEVFQGPQGG---------------FTVEFPTKNG--------VALHISVRMGSYGQNVIVFNH 70

  Fly    96 RLKGKWGPEE-NSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLG 159
            ..:|:|..|| :.:.:.|    |:.|.|:|......:.|.|:|:|...|.|....:.:.|:.|.|
 Worm    71 LQRGRWHREEHHQNTIMF----GRPFCMRIHNEHRKYSIHVDGHHIGHYHHHKCPKRIVAMTVRG 131

  Fly   160 DV 161
            |:
 Worm   132 DL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 42..162 CDD:459768 33/124 (27%)
Gal-bind_lectin 237..367 CDD:459768
lec-11NP_001023191.1 GLECT 11..139 CDD:238025 37/132 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.