DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and pqn-84

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_499514.3 Gene:pqn-84 / 176601 WormBaseID:WBGene00004165 Length:392 Species:Caenorhabditis elegans


Alignment Length:106 Identity:30/106 - (28%)
Similarity:46/106 - (43%) Gaps:26/106 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 NFLIEGSSLRIEGRVRLMPQRFSIAFQK------GQEIWPQPTVS-FYFSPCFLRS---RHDKIG 289
            |.:.|.|.|.:..||:.:  |.||.:..      |::...||.:| .|:|...|:.   ....:|
 Worm    71 NSVYEKSPLSLHIRVQYL--RNSIIYNSWFGSWGGEQFSQQPFLSGNYYSISVLKGPTYYSIYMG 133

  Fly   290 TAIITRRAYLN------------GDWVNCTVSRLNTSLRPG 318
            ..:||:.|:.|            |||...:||.  |.:|||
 Worm   134 NLLITKYAFRNPANWQIGNLLGYGDWTVTSVSM--TCVRPG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752
Gal-bind_lectin 226..369 CDD:278752 30/106 (28%)
pqn-84NP_499514.3 Gal-bind_lectin 33..164 CDD:334017 24/94 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.