DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lec-4

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_497763.1 Gene:lec-4 / 175488 WormBaseID:WBGene00002267 Length:283 Species:Caenorhabditis elegans


Alignment Length:332 Identity:71/332 - (21%)
Similarity:124/332 - (37%) Gaps:94/332 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEENSSYLTFQL 114
            ||.|....:...|:.| :.|.||.....|:|.:.....:..:..||...|.||.||..| |.|| 
 Worm    31 HGKINEGAQVAEINLL-QGGGEIGPNTQVILHLKLNFKEKKVILNSYENGVWGKEERES-LPFQ- 92

  Fly   115 NRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVSDIVIDTYYVSEYPIRLT 179
             .|:.|.::|.:.:|...||.:.....::.||:|::.:|.:.|.||:|                 
 Worm    93 -AGQEFDLRIRVLDEGLEISADNKKIHEFKHRLPFQSIEYLSVRGDLS----------------- 139

  Fly   180 HSLPRPIPHSNKLPRDGENVETEWMVLSSLAKMSSKKFLYQPSLPLPFYGKLLKENFLIEGSSLR 244
                     .|.:...|...:..|                :.:.|         ..||.:|..:.
 Worm   140 ---------LNGIHWGGRFYKLPW----------------ETAFP---------AGFLEKGQRVH 170

  Fly   245 IEGRVRLMPQ--RFSI-AFQKGQEIWPQPTVSFYFSPCFLRSRHDKIGTAIITRRAYLNGDWVNC 306
            :.|    :|:  |:|: ...:.|:|      .|:|:|        :|....:.|.::.||.|   
 Worm   171 LYG----IPKGDRWSLDLVARNQDI------LFHFNP--------RIKDKAVVRNSHRNGFW--- 214

  Fly   307 TVSRLNTSLRPGG-------AFVIVIACRDSYYELFVNNRSLFHFKYQMRPECVDIVNIRGDIKL 364
                 :|..|.||       .|.:.|...:...::|:|......|:::.:....|.:.:|.|   
 Worm   215 -----DTEEREGGFPFKKDVGFDLTIVNEEYSIQIFINRERFGTFQHRTQNPIGDYIGLRID--- 271

  Fly   365 WEVAIQG 371
            .||.:.|
 Worm   272 GEVEVTG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 34/111 (31%)
Gal-bind_lectin 226..369 CDD:278752 31/152 (20%)
lec-4NP_497763.1 GLECT 14..145 CDD:214596 36/143 (25%)
GLECT 154..282 CDD:214596 34/179 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I5463
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28669
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm4724
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.