DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lec-2

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001379091.1 Gene:lec-2 / 174560 WormBaseID:WBGene00002265 Length:1245 Species:Caenorhabditis elegans


Alignment Length:119 Identity:33/119 - (27%)
Similarity:54/119 - (45%) Gaps:9/119 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEENS 107
            ||......|:.....:.|.|:.|.|.|       |:.|.:.:|..:.::.|||.:...||.||..
 Worm  1128 PGKTLTVFGIPEKKAKRFHINLLKKNG-------DIALHLNARFDEKHVVRNSLINSAWGNEERE 1185

  Fly   108 SYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDV 161
            ..:.|:  :...|.::|......|.::|||..||.|.||:....:..:.:.|||
 Worm  1186 GKMPFE--KAVGFDLEIHNEPYAFAVTVNGERFASYAHRLSPDEVNGLQIGGDV 1237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 33/119 (28%)
Gal-bind_lectin 226..369 CDD:278752
lec-2NP_001379091.1 rne <136..298 CDD:236766
PRK14949 <235..662 CDD:237863
rne <474..771 CDD:236766
rne <794..963 CDD:236766
GLECT 978..1108 CDD:214596
GLECT 1116..1243 CDD:238025 33/119 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I5463
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm4724
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.