DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals7

DIOPT Version :10

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_032522.2 Gene:Lgals7 / 16858 MGIID:1316742 Length:136 Species:Mus musculus


Alignment Length:120 Identity:37/120 - (30%)
Similarity:57/120 - (47%) Gaps:6/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEEN 106
            |.|......||:......|.::.|.  |.|  :..|..|....||..:.:..|::.:||||.||.
Mouse    15 RVGTVMRIRGMVPDQAGRFHVNLLC--GEE--QGADAALHFNPRLDTSEVVFNTKEQGKWGREER 75

  Fly   107 SSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDV 161
            .:.:.|:  ||:.|.:.::.|||.|...|....:..:.||||...:..|:|.|||
Mouse    76 GTGIPFE--RGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 42..162 CDD:459768 37/120 (31%)
Gal-bind_lectin 237..367 CDD:459768
Lgals7NP_032522.2 Gal-bind_lectin 11..133 CDD:459768 37/120 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.