DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals3

DIOPT Version :10

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_034835.1 Gene:Lgals3 / 16854 MGIID:96778 Length:264 Species:Mus musculus


Alignment Length:134 Identity:38/134 - (28%)
Similarity:57/134 - (42%) Gaps:20/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PRPG-----LCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQN---YITRNSRL 97
            |.||     :.....|.:.......|:||  ::|:      ||......|..:|   .|..|::.
Mouse   135 PLPGGVMPRMLITIMGTVKPNANRIVLDF--RRGN------DVAFHFNPRFNENNRRVIVCNTKQ 191

  Fly    98 KGKWGPEENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVS 162
            ...||.||..|  .|....||.|.:|:|:..:.|.::||..|..:|.|||  :.|..:..||...
Mouse   192 DNNWGKEERQS--AFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRM--KNLREISQLGISG 252

  Fly   163 DIVI 166
            ||.:
Mouse   253 DITL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 42..162 CDD:459768 35/127 (28%)
Gal-bind_lectin 237..367 CDD:459768
Lgals3NP_034835.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105
PRK07764 <9..139 CDD:236090 2/3 (67%)
9 X 9 AA tandem repeats of Y-P-G-X(3)-P-[GS]-A 35..114
Gal-bind_lectin 137..258 CDD:214904 37/132 (28%)
Nuclear export signal 240..255 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.