DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and CLC

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001819.2 Gene:CLC / 1178 HGNCID:2014 Length:142 Species:Homo sapiens


Alignment Length:158 Identity:41/158 - (25%)
Similarity:70/158 - (44%) Gaps:23/158 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LPLPFYGKLLKENFLIEGSSLRIEGR---VRLMPQRFSIAFQKGQEIWPQPTVSFYFSPCFLRSR 284
            ||:|:    .:...|..||::.|:||   ..|......:.|.  .|:..:..:.|:|..||.|  
Human     4 LPVPY----TEAASLSTGSTVTIKGRPLACFLNEPYLQVDFH--TEMKEESDIVFHFQVCFGR-- 60

  Fly   285 HDKIGTAIITRRAYLNGDWVNCTVSRLNTSLRPGGAFVIVIACRDSYYELFVNNRSLFHFKYQMR 349
                 ..::..|.|  |.|.....|: |...:.|..|.:.|:.....|::.||.:|.:.|.::::
Human    61 -----RVVMNSREY--GAWKQQVESK-NMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIK 117

  Fly   350 PECVDIVNIRGDIKLWEVAIQGNTTYKK 377
            ||.|.:|.:..||.|.:.    |.:|.|
Human   118 PEAVKMVQVWRDISLTKF----NVSYLK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752
Gal-bind_lectin 226..369 CDD:278752 36/145 (25%)
CLCNP_001819.2 Gal-bind_lectin 5..137 CDD:278752 37/151 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.