DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Grifin

DIOPT Version :10

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_476535.2 Gene:Grifin / 117130 RGDID:71055 Length:144 Species:Rattus norvegicus


Alignment Length:119 Identity:33/119 - (27%)
Similarity:47/119 - (39%) Gaps:10/119 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEENS 107
            ||......|......:.|.|:|||..|       |:...:..|.....:..|:...|:||.||.|
  Rat    15 PGWSLTVQGHADAGEDKFEINFLTDAG-------DIAFHVKPRFSSATVVGNAFQGGRWGQEEVS 72

  Fly   108 SYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHR-MPYRWLEAVDVLGD 160
            |  .|.|..|:.|.:::....|.|.|........::.|| .|...:..|.||.|
  Rat    73 S--VFPLTLGEPFEVEVSADTEHFHIYAQEQKVLQFPHRHRPLATITRVRVLSD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 42..162 CDD:459768 33/119 (28%)
Gal-bind_lectin 237..367 CDD:459768
GrifinNP_476535.2 Gal-bind_lectin 11..131 CDD:459768 33/119 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.