DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and Lgals2

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_079898.2 Gene:Lgals2 / 107753 MGIID:895068 Length:130 Species:Mus musculus


Alignment Length:118 Identity:25/118 - (21%)
Similarity:51/118 - (43%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRLPQNYITRNSRLKGKWGPEEN 106
            :||:.....|.|....:.|:|:.  .||.|...     |....|..::.|..|:...|:||.|:.
Mouse    13 KPGMSLKIKGKIHNDVDRFLINL--GQGKETLN-----LHFNPRFDESTIVCNTSEGGRWGQEQR 70

  Fly   107 SSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLG 159
            .:::.|  :.|....:.|...::.|.:::...|...:.:|:.:..|..:.:.|
Mouse    71 ENHMCF--SPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 25/118 (21%)
Gal-bind_lectin 226..369 CDD:278752
Lgals2NP_079898.2 GLECT 11..130 CDD:214596 25/118 (21%)
Beta-galactoside binding. /evidence=ECO:0000255 65..71 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.