DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lgals12

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_002937539.2 Gene:lgals12 / 100487358 XenbaseID:XB-GENE-6462760 Length:312 Species:Xenopus tropicalis


Alignment Length:335 Identity:72/335 - (21%)
Similarity:119/335 - (35%) Gaps:67/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPGLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSRL--PQNYITRNSRLKGKWGPE 104
            |||...:..|.:......|.||.  :.|.......||......|.  .:..:..|:..:.:|..|
 Frog    30 RPGKMILVQGRVSGTANRFSIDL--QVGCSTRPRADVAFHFNPRFSSSETLVVCNTLTREQWLHE 92

  Fly   105 ENSSYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVSDIVIDTY 169
            ::  :|..||.:|:.|.:..|:.|:...:|:.|.|...|.:|:|...::.:.:.||||  |....
 Frog    93 DH--HLCPQLRKGQPFLLLFLILEDKIKVSIEGQHLLDYPNRLPLCDVDTLGICGDVS--VQGIS 153

  Fly   170 YVSEYPIRLTHSLPRPIPHSNKLPRDGENVETEWMVLSSLAKMSSKKFLYQPSLPLPFYGKLLKE 234
            ::...|.                 .||   :||:.:...| |:.:.......|.|||        
 Frog   154 FLCRNPF-----------------SDG---DTEYPLCQPL-KLGNVAMATPLSKPLP-------- 189

  Fly   235 NFLIEGSSLRIEGRVRLMPQRFSIAFQKGQEIWPQPTVSFYFSPCFLRSRHDKIGTAIITRRAYL 299
            |.:.:|....:.|.....|....|..:.|..|..:.|.||            |..|.:..   ||
 Frog   190 NGISDGHMTTVRGLASASPDEIIILLKSGDFIPFKLTASF------------KDQTLLYN---YL 239

  Fly   300 NGD-WVNCTVSRLNTS---LRPGGAFVIVIACRDSYYELFVNNRSLFHFKYQMRPECVDI----- 355
            .|. |..  ...:.|.   ......|.|.|......::|.:|...|..|.    |..:|:     
 Frog   240 MGPLWAK--PQEIQTPFFLFHAERFFEIRIFSETRGFKLAINGVPLDVFS----PPALDLKSIDE 298

  Fly   356 VNIRGDIKLW 365
            :.|.|.:|::
 Frog   299 IQINGSVKVY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 29/121 (24%)
Gal-bind_lectin 226..369 CDD:278752 30/149 (20%)
lgals12XP_002937539.2 Gal-bind_lectin 27..153 CDD:214904 32/128 (25%)
Gal-bind_lectin 189..310 CDD:214904 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.