DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11374 and lgals9c

DIOPT Version :9

Sequence 1:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_012811742.1 Gene:lgals9c / 100124899 XenbaseID:XB-GENE-988896 Length:316 Species:Xenopus tropicalis


Alignment Length:346 Identity:76/346 - (21%)
Similarity:138/346 - (39%) Gaps:73/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GLCFVFHGMILMACEHFVIDFLTKQGSEICEECDVLLQIGSR-LPQNYITRNSRLKGKWGPEENS 107
            |...|..|::..:.:.|.|:|.....|    ..||......| :....:..|::.:..||.|||.
 Frog    24 GFLVVISGVVCPSGDRFNINFQCGHSS----NDDVAFHFNPRFIDGGIVVCNTKERNSWGREENK 84

  Fly   108 SYLTFQLNRGKSFWMQILLTEECFFISVNGYHFAKYFHRMPYRWLEAVDVLGDVSDIVIDTYYVS 172
            ..:.|  :|.:.|.::||::...:.:|||..||.:|.||:|.:.:..:.:.|.|:   :...:|.
 Frog    85 REMPF--HRHQPFEIRILVSNHSYNVSVNRNHFVEYHHRIPIQRVNTLTIGGCVN---LTCVHVQ 144

  Fly   173 E----YPIRLTHSLPRPIPHS-----NKLPRDGENVETEWMVLSSLAKMSSKKFLYQPSL-PLPF 227
            :    :|.:.....|...||.     .:.|..|                     .:.|.: .:|:
 Frog   145 QQGGGFPPQHFPGAPTFSPHQPGYLPQQFPPGG---------------------AFNPQVYAIPY 188

  Fly   228 YGKLLKENFLIEGSSLRIEGRVRLMPQRF--SIAFQKGQEIWPQPTVSFYFSPCFLRSRHDKIGT 290
            ..|:  .........:.:.|.|...|:||  ::.|..|        .:.:|:|.|  ..|     
 Frog   189 QTKI--HGGFFPSKMIAVRGTVPAHPKRFHLNLKFHGG--------TALHFNPRF--DEH----- 236

  Fly   291 AIITRRAYLNGDWVNCTVSRLNTSL------RPGGAFVIVIACRDSYYELFVNNRSLFHFKYQMR 349
             .|.|.::|||.|     .:...:|      .||.:|||.|.|....:::.||...:..|.:::.
 Frog   237 -TIVRNSHLNGSW-----GKEERNLPSGMVFSPGQSFVIEIRCEQHAFKVHVNGAHICDFNHRVH 295

  Fly   350 P-ECVDIVNIRGDIKLWEVAI 369
            . :.:|.:.|.||:.|..|.:
 Frog   296 SLQQIDTLQIEGDVVLQHVQV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 31/118 (26%)
Gal-bind_lectin 226..369 CDD:278752 36/151 (24%)
lgals9cXP_012811742.1 Gal-bind_lectin 12..142 CDD:366037 32/126 (25%)
GLECT 187..315 CDD:238025 35/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7543
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4497
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 1 1.000 - - mtm9348
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.