DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Grifin

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_084298.1 Gene:Grifin / 77998 MGIID:1925248 Length:144 Species:Mus musculus


Alignment Length:141 Identity:46/141 - (32%)
Similarity:67/141 - (47%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSS 208
            |.|:.|.|.||.|:.....|:|.||.:  .|:.|:|.|:.||.....:|.|......||.|||||
Mouse    11 GGLAPGWSLTVQGHADAGEEKFEINFL--TDAGDIAFHVKPRFSSATVVGNAFQGGRWGQEEVSS 73

  Fly   209 ALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTH-----RIPYRD--------VRILEVKGD 260
            ..|  |:.||.|.::|         |.:.:||..|..     :.|:|.        ||:|. :..
Mouse    74 IFP--LTLGEPFEMEV---------SADAEHFHIYAQEQKVLQFPHRHRPLATITRVRVLS-EHR 126

  Fly   261 VSNVEM-KRTL 270
            ::.||: ||:|
Mouse   127 LAQVELAKRSL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 41/130 (32%)
Gal-bind_lectin 346..479 CDD:459768
GrifinNP_084298.1 Gal-bind_lectin 11..131 CDD:459768 41/133 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.