DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and LGALS7B

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001035972.1 Gene:LGALS7B / 653499 HGNCID:34447 Length:136 Species:Homo sapiens


Alignment Length:121 Identity:42/121 - (34%)
Similarity:63/121 - (52%) Gaps:7/121 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LSEGIS----FTVTGNLSVNCERFSINLVYNND-SRDVALHINPRLPQNYIVRNTKVQDIWGNEE 205
            |.|||.    ..:.|.:..|..||.:||:...: ..|.|||.||||..:.:|.|:|.|..||.||
Human    10 LPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREE 74

  Fly   206 VSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV 261
            ....:||  .||:.|.:.::.::..:...|....:..:.||:|...||::||.|||
Human    75 RGPGVPF--QRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 42/121 (35%)
Gal-bind_lectin 339..479 CDD:278752
LGALS7BNP_001035972.1 Gal-bind_lectin 11..133 CDD:214904 41/120 (34%)
Beta-galactoside binding. /evidence=ECO:0000255 70..76 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.