DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and si:ch211-10a23.2

DIOPT Version :10

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001139237.1 Gene:si:ch211-10a23.2 / 567812 ZFINID:ZDB-GENE-090313-9 Length:149 Species:Danio rerio


Alignment Length:136 Identity:34/136 - (25%)
Similarity:63/136 - (46%) Gaps:19/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DQIGKLSEGISFT----VTGNLSVNCERFSINLVYNNDSR---------DVALHINPRLPQNYIV 192
            |.:|::..|:..|    |.|  .|:.:..|:.::.:..|:         ||.|.:....|:..::
Zfish    12 DYVGEIKGGLRPTMRLIVMG--IVHKQPKSMVVIVSCQSKGEGDEEIEGDVGLELKVNFPEKAVL 74

  Fly   193 RNTKVQDIWGNEEVS-SALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHR-IPYRDVRIL 255
            ||.::...||:.|.: |..||  :.||.|.::::.....:.|.|:||....:.|| .....:..|
Zfish    75 RNARLSGKWGSSETALSFFPF--APGEAFKMEIVCEHQQFRILVDGQPLCGFAHRQTQLASLNAL 137

  Fly   256 EVKGDV 261
            .|.||:
Zfish   138 RVHGDL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 33/134 (25%)
Gal-bind_lectin 346..479 CDD:459768
si:ch211-10a23.2NP_001139237.1 Gal-bind_lectin 19..148 CDD:214904 32/129 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.