DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and Lgals12

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001343503.1 Gene:Lgals12 / 56072 MGIID:1929094 Length:314 Species:Mus musculus


Alignment Length:371 Identity:84/371 - (22%)
Similarity:141/371 - (38%) Gaps:84/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 EYADAVPKYFNDQ--------------IGKLSEGISFTVTGNLSVNCERFSINLVYN---NDSRD 177
            |:.|.:|..|..|              .|.|..|...|:.|.:.::..||.::....   :...|
Mouse     5 EHLDPIPDSFILQPPVFHPVIPYGTTIFGGLYAGKMVTLQGVVPLHARRFQVDFQCGCCLHPQPD 69

  Fly   178 VALHINPRL--PQNYIVRNTKVQDIWGNEEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHF 240
            ||...:||.  .:.:::.||....:|..|.....:  .|.||:.|.|..|.......:|||||||
Mouse    70 VAFRFSPRFYTVKPHVICNTHQGGLWQKEIRWPGV--ALQRGDSFLILFLFENEEVKVSVNGQHF 132

  Fly   241 AAYTHRIPYRDVRILEVKGDVSNVEMKRTLVLKYPERLPQSEANNIELHIDDGINEIDASVEETV 305
            ..|.:|:|...|..|::.||:        ||...                  |...|:..||.:.
Mouse   133 LHYRYRLPLSRVDTLDISGDI--------LVKAV------------------GFLNINPFVEGSR 171

  Fly   306 KIPHEWCIISAPNTQSDSSPKRNNSSNDLGLTLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYI 370
            :.|..:..:.       .||:         |.:|...|| |..|..|:.:.:.|.|...|..|.:
Mouse   172 EYPVGYPFLL-------YSPR---------LEVPCSRAL-PRGLWPGQVIVVRGLVLKEPKDFTL 219

  Fly   371 NLQQGQDIWPHPVIAFHLNPRFSKASSGAIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCL 435
            :|:.|....|     ..|...|:..:.           ||:: :|.:::.......|.|.|.|.:
Mouse   220 SLKDGTTHVP-----VTLRASFTDRTL-----------AWVS-SWGRKKLISAPFLFHPQRFFEV 267

  Fly   436 AIVCTKTSFEVYVNRQFM--TDFKYKVSPEVVDTVYIQGDVKLWNV 479
            .::|.:...::.:|.|.:  |....| :.|.:..:.|.|:|.|:.|
Mouse   268 LLLCQEGGLKLALNGQGLGATSLDQK-ALEQLRELRISGNVHLYCV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 36/123 (29%)
Gal-bind_lectin 339..479 CDD:278752 32/141 (23%)
Lgals12NP_001343503.1 Gal-bind_lectin 26..158 CDD:366037 38/141 (27%)
Gal-bind_lectin 195..313 CDD:214904 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840836
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.