DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galectin and lgals3a

DIOPT Version :9

Sequence 1:NP_608487.1 Gene:galectin / 33162 FlyBaseID:FBgn0031213 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001373725.1 Gene:lgals3a / 557373 ZFINID:ZDB-GENE-030131-7667 Length:368 Species:Danio rerio


Alignment Length:111 Identity:34/111 - (30%)
Similarity:61/111 - (54%) Gaps:6/111 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEVSSALPFLLSRG 217
            |:.|...:..:||.::.:..:   :|..|.|||..:|.:|||:::..:||.||.....||:  :|
Zfish   254 TIVGEPIIGGDRFHVDFMRGH---EVVFHFNPRFHENTVVRNSQLGGLWGPEEREGGFPFV--QG 313

  Fly   218 EEFSIQVLVTEACYMISVNGQHFAAYTHRI-PYRDVRILEVKGDVS 262
            .:|.:::||....:.::|:|.|...:.||. ...||..|.:.|||:
Zfish   314 RQFELKILVETDGFKVAVDGVHLLEFEHRTGGMEDVTRLRIDGDVT 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galectinNP_608487.1 GLECT 143..262 CDD:238025 33/109 (30%)
Gal-bind_lectin 339..479 CDD:278752
lgals3aNP_001373725.1 PRK07764 <11..158 CDD:236090
Gal-bind_lectin 246..362 CDD:214904 34/111 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9258
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D357844at33208
OrthoFinder 1 1.000 - - FOG0000178
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X133
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.